L o a d i n g
Organization
US Department of Transportation - view all
Update frequencyunknown
Last updatedlast year
Format
Overviewair-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatsdefectdefectsemailequipmentfmvssinvestigationinvestigationsoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehicles
About the Data The dataset includes publicly available NHTSA investigation information related to the identification and correction of safety-related defects in motor vehicles and vehicle equipment. For more information on NHTSA investigations, including safety defect investigations, please visit https://www.nhtsa.gov/resources-investigations-recalls.
Additional Information
KeyValue
Categories{}
Common Core Contact EmailNHTSA-Datahub@dot.gov
Common Core Contact NameNHTSA-Datahub
Common Core Homepagehttps://nhtsa.gov/recalls
Common Core Is Quality Datatrue
Common Core Languageen-US
Common Core Licensehttp://www.usa.gov/publicdomain/label/1.0/
Common Core Program Code021:031
Common Core Public Access Levelpublic
Common Core PublisherNational Highway Traffic Safety Administration
Common Core Update Frequency R/P1D
LicensePublic Domain U.S. Government
Owner Display NameNHTSA-Data Team
Source Created At2024-01-31T14:18:07.000Z
Source Updated At2025-03-27T10:11:34.000Z
